GLP-1
Cagrilintide Dosage, Protocol & Research Guide
- MW 4,409 g/mol
- CAS 1415456-99-3
Dose overview
Every range below is taken from the cited source and carries its evidence grade.
Human data and community reports
| Source | Population | Dose | Frequency | Route | Duration | Evidence |
|---|---|---|---|---|---|---|
| Phase 2 dose-finding trial (Lancet 2021, doi 10.1016/S0140-6736(21)01751-7; NCT03856047; 706 adults assigned to cagrilintide)[2] | humanadults without diabetes with BMI 30 or higher, or 27 or higher with hypertension or dyslipidaemia, phase 2 trial | 0.3–4.5 mg[2]subcutaneous, trial dose arms 0.3, 0.6, 1.2, 2.4 and 4.5 mg once weekly; 0.3 mg is the lowest arm | once weekly | subcutaneous | — | Human clinical trialStudy details from the source: Phase 2 dose-finding trial (Lancet 2021, doi 10.1016/S0140-6736(21)01751-7; NCT03856047; 706 adults assigned to cagrilintide): subcutaneous self-injection once weekly at 0.3, 0.6, 1.2, 2.4 or 4.5 mg for 26 weeks including a dose-escalation period of up to 6 weeks, versus liraglutide 3.0 mg once daily or placebo |
Evidence grades: A approved label, B human trial, C observational, D animal study, E community-reported.
Reconstitution calculator
- Concentration
- 2.5 mg/mL
- Volume to draw
- 0.1 mL
- Units on a U-100 syringe
- 10 units
- Draws per vial
- 20
Properties
- CAS
- 1415456-99-3
- Molecular weight
- 4,409 g/mol
- Formula
- Not yet recorded
- Sequence
- XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
- Aliases
- NN0174-0833, AM833
- Vial sizes (mg)
- 5, 10
Storage notes
- Lyophilized
- Not yet recorded from a cited source
- Reconstituted stability (days)
- Not yet recorded from a cited source
Side effects, contraindications and regulatory status
Reported side effects
- Phase 2 trial (Lancet 2021, 26 weeks): the most frequent adverse events were gastrointestinal disorders (nausea, constipation, diarrhoea) and administration-site reactions.[2] Human trial
- Phase 2 trial: gastrointestinal adverse events occurred in 41% to 63% of participants on cagrilintide 0.3-4.5 mg vs 32% on placebo, mainly nausea (20% to 47% vs 18%).[2] Human trial
- Phase 2 trial: permanent discontinuation of study drug was 10% overall and similar across groups, mostly due to adverse events (4%).[2] Human trial
- Combination data, not cagrilintide alone: in REDEFINE 1 (NEJM 2025, cagrilintide 2.4 mg + semaglutide 2.4 mg, 68 weeks) gastrointestinal adverse events affected 79.6% vs 39.9% on placebo.[3] Human trial
- Combination data, not cagrilintide alone: in REDEFINE 2 (NEJM 2025, type 2 diabetes) gastrointestinal adverse events were reported by 72.5% vs 34.4% on placebo.[4] Human trial
Cautions from reviews and trials
- Trial exclusions, not contraindications (no label exists): the phase 2 trial excluded HbA1c of 48 mmol/mol (6.5%) or more at screening and a self-reported body weight change over 5 kg in the prior 90 days (registry NCT03856047).[5] Human trial
Regulatory status
Investigational alone; Novo Nordisk H1 2026 report (2026-08-04) lists cagrilintide phase 3 initiation and a 2026 US decision for CagriSema; no approval stated[1] Source
Report any adverse reaction to a qualified healthcare professional.
What the research says
Summaries of the cited studies, each with its evidence grade.
Phase 2 dose-finding trial (Lancet 2021, doi 10.1016/S0140-6736(21)01751-7; NCT03856047; 706 adults assigned to cagrilintide)[2]
Phase 2 dose-finding trial (Lancet 2021, doi 10.1016/S0140-6736(21)01751-7; NCT03856047; 706 adults assigned to cagrilintide): subcutaneous self-injection once weekly at 0.3, 0.6, 1.2, 2.4 or 4.5 mg for 26 weeks including a dose-escalation period of up to 6 weeks, versus liraglutide 3.0 mg once daily or placebo
Compare vial sizes
| Size | Price | Doses available from the vial Calculated | Cost per dose Calculated |
|---|---|---|---|
| 10 mg | $99.99 | 33 | $3.03 |
Cost per dose uses the listed partner price and the reference dose cited on this page. Prices change; check the product page.
Calculated from a default of 2 mL water (adjustable).
PeptideCheck may earn a commission when you use Pepcore links, at no extra cost to you. Read the disclosure.
Frequently asked questions
What dose figures are published for Cagrilintide?
Cited figures on this page: 0.3-4.5 mg once weekly, subcutaneous, trial dose arms 0.3, 0.6, 1.2, 2.4 and 4.5 mg once weekly; 0.3 mg is the lowest arm [2] (Human clinical trial, evidence grade B). These are summaries of published sources, not medical advice. Each figure links to its source in the references.
What study duration is cited for Cagrilintide?
The cited duration is 26 weeks, with no off period stated (Human clinical trial). It describes the source, not a recommendation.
What is the regulatory status of Cagrilintide?
Investigational alone; Novo Nordisk H1 2026 report (2026-08-04) lists cagrilintide phase 3 initiation and a 2026 US decision for CagriSema; no approval stated
Compound facts
What is the molecular weight of Cagrilintide?
What is the CAS number of Cagrilintide?
How is Cagrilintide stored in the laboratory?
References
Numbered sources used on this page. Markers in the text link here.
- sec.gov
- Phase 2 dose-finding trial (Lancet 2021, doi 10.1016/S0140-6736(21)01751-7; NCT03856047; 706 adults assigned to cagrilintide) pubmed.ncbi.nlm.nih.gov Human trial
- pubmed.ncbi.nlm.nih.gov Human trial
- pubmed.ncbi.nlm.nih.gov Human trial
- clinicaltrials.gov Human trial
Vial sizes and protocols
10 mgPartner size
- Doses per vial
- 33
Calculated from a default of 2 mL water (adjustable).
Available from Pepcore
Supplied as research material for laboratory use only.
- Cagrilintide Research Material – 10mg 10 mg$99.99Shop at PepcoreCoupon code
LAUNCH20
PeptideCheck may earn a commission when you use Pepcore links, at no extra cost to you. Read the disclosure.