For research use only. Not for human or veterinary use. Not for diagnostic or therapeutic use.
Menu
Reconstitution calculator

GH secretagogue

Sermorelin Dosage, Protocol & Research Guide

By Sam, MBA

Label figures describe the approved branded products. The research materials listed on this page are not approved drugs and are not evaluated by any regulator.

  • MW 3,357.9 g/mol
  • CAS 86168-78-7
Dosage, protocol, reconstitution and storage reference for Sermorelin, with a reconstitution calculator, vial sizes and cited research.

Reconstitution calculator

Sizes in published sources5 mg10 mg

Calculator example, not a recommended amount

Concentration
2.5 mg/mL
Volume to draw
0.1 mL
Units on a U-100 syringe
10 units

0102030405060708090100

Properties

CAS
86168-78-7
Molecular weight
3,357.9 g/mol
Formula
Not yet recorded
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Aliases
Not yet recorded
Vial sizes (mg)
5, 10

Storage

Lyophilised (dry powder)

Store at 2 to 8 °C and protect from light; shelf life 2 years (Geref 50 Summary of Product Characteristics, Irish Medicines Board, printed 2006).[2]

After reconstitution

Use immediately after reconstitution
not stated; reconstitute immediately before use and discard any product remaining after use[2]

Source

Storage notes

Lyophilized
Not yet recorded from a cited source
Reconstituted stability (days)
Not yet recorded from a cited source

Side effects, contraindications and regulatory status

Reported side effects

  • Geref 50 Summary of Product Characteristics (Irish Medicines Board, printed 2006; diagnostic test of pituitary function) section 4.8: facial heat, facial flush and injection site pain occasionally occur and usually disappear within a few minutes.[2] Approved label
  • Review of sermorelin in children with idiopathic GH deficiency (BioDrugs 1999): transient facial flushing and injection site pain were the most commonly reported adverse events; the reviewers describe it as well tolerated.[3] Observational
  • Regulatory history: Geref (sermorelin acetate) was discontinued by EMD Serono in 2008 and its NDAs withdrawn effective 2009-06-18; the FDA 2013 notice states the products were not withdrawn for reasons of safety or effectiveness.[1] Regulator or expert-panel statement

Contraindications

  • Geref 50 SPC section 4.3: known hypersensitivity to sermorelin acetate or any excipient; use during pregnancy or lactation.[2] Approved label

Regulatory status

No current US label: Geref (EMD Serono) discontinued 2008, NDAs 20-443 and 19-863 withdrawn effective 2009-06-18; FDA 2013 notice: not withdrawn for safety or effectiveness. Checked 2026-10-20.[1] Source

Report any adverse reaction to a qualified healthcare professional.

What the research says

Summaries of the cited studies, each with its evidence grade.

  • Geref 50 Summary of Product Characteristics (Irish Medicines Board, printed 2006)[2]

    Approved label human

    Geref 50 Summary of Product Characteristics (Irish Medicines Board, printed 2006): single intravenous injection of 1.0 microgram/kg body weight in the morning after an overnight fast, to evaluate pituitary somatotroph function; blood samples 15 minutes before and up to 60 minutes after the injection

    Approved product label

  • Review of sermorelin in children with idiopathic growth hormone deficiency (BioDrugs 1999, doi 10.2165/00063030-199912020-00007)[3]

    Observational human

    Review of sermorelin in children with idiopathic growth hormone deficiency (BioDrugs 1999, doi 10.2165/00063030-199912020-00007): once-daily subcutaneous sermorelin 30 mcg/kg bodyweight at bedtime; single intravenous 1 mcg/kg dose for diagnostic testing; original Geref label not located

    Human review or observational report

Frequently asked questions

How is lyophilised Sermorelin stored?

Cited storage for the lyophilised vial: Store at 2 to 8 °C and protect from light; shelf life 2 years (Geref 50 Summary of Product Characteristics, Irish Medicines Board, printed 2006)..

How long is reconstituted Sermorelin kept?

The source says to use it immediately after reconstitution [2].

What is the regulatory status of Sermorelin?

No current US label: Geref (EMD Serono) discontinued 2008, NDAs 20-443 and 19-863 withdrawn effective 2009-06-18; FDA 2013 notice: not withdrawn for safety or effectiveness. Checked 2026-10-20.

Compound facts

Recorded molecular weight: 3,357.9 g/mol.
Recorded CAS number: 86168-78-7
Not yet recorded from a cited source.

Sources

https://pubchem.ncbi.nlm.nih.gov/compound/16132413
PubMed IDs
18031173

References

Numbered sources used on this page. Markers in the text link here.

  1. govinfo.gov Regulator or expert-panel statement
  2. Geref 50 Summary of Product Characteristics (Irish Medicines Board, printed 2006) assets.hpra.ie Approved label
  3. Review of sermorelin in children with idiopathic growth hormone deficiency (BioDrugs 1999, doi 10.2165/00063030-199912020-00007) pubmed.ncbi.nlm.nih.gov Observational